PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009771804.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family FAR1
Protein Properties Length: 246aa    MW: 28645 Da    PI: 6.5958
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009771804.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR161.82e-1956140390
            FAR1   3 YneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHela 90 
                     Yn+YA   GF +rk +++++ rn+e t+  f Cs+egk+   ++   +++++r e r+gC a++k k + ++kw+v +++ eHnH++ 
  XP_009771804.1  56 YNSYALAKGFGIRKGAKTYN-RNKELTRCLFLCSCEGKSLLYSNY-LERKHQRLEYRCGCMARIKFKIS-NEKWKVFEFSDEHNHPMI 140
                     ****************9998.7888****************9999.89999****************99.***************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031013.5E-1656140IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 246 aa     Download sequence    Send to blast
MEDHSAHEDI NFEGEYYTAN DQDCSTFVHN GSNINNDFTI KIGMKFGSED ESYVAYNSYA  60
LAKGFGIRKG AKTYNRNKEL TRCLFLCSCE GKSLLYSNYL ERKHQRLEYR CGCMARIKFK  120
ISNEKWKVFE FSDEHNHPMI EENLRHFILS GQNLTTATKD ILSSMVDAGI RTKKVVRYLQ  180
NEAGGIENAR FIEQDAHNFI QARKRSMINS GDAQTFVDRF MHMQSEDSNF FYSFQVDEDG  240
RMCNFF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009771804.10.0PREDICTED: putative protein FAR1-RELATED SEQUENCE 10
TrEMBLK4BG863e-99K4BG86_SOLLC; Uncharacterized protein
STRINGSolyc03g044690.1.11e-98(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA1726931
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.11e-21FAR1-related sequence 5